Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

     ⌊ Family valine cyclopropanase

  ⌊ FunctionalDomain valine cyclopropanase (Swb7) (ID 419746)

Superfamily Assignment Evidence Code(s) ISS PubMed:19514719
Family Assignment Evidence Code CFM PubMed:19514719
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces sp. SNA15896 Taxon ID: 497689 283131228

Uniprot

Protein NameAccessionEC Number Identifier
n/a D2KTX6 D2KTX6_9ACTN (TrEMBL)

Sequence

Length of Enzyme (full-length): 478 | Length of Functional Domain: 478

1       10        20        30        40        50        60

MLISSVSPAHRYALEIATMAKAAVPGVFVVLGGRHVDETITCLPGKDMLMVAPSSTLSVI
RTGKVPPVVDATISGEAYYSLDLLMRAIAAAVDLDTDLVRPDAVRTLLEELLSEQEPMPG
RSLITLLTPETTLAYPQEGPKIDLSALPSPYEGFAIRSRFPIFVDPRTDEIRRTAHVMVS
NACPYQCNFCSETAKLAGGLKKFRQTSAGVNRVVEYVGYGAEALFFDDSVFWSGTYRDVV
DFCEELCRIRETPAGKLAEHHRRLLPTAADVERLGRLEWGAQLTVDVLVALHSLEESRRT
LEIMRAAGCSYVYIGIESMSDQVMDKIHKNLRRVEGHSWAEKVRAAVSLVKSTGLRVGTS
VLFGLEGETRASIDETIAGVSNLIADKLIDLASPNILTYHPATPITRIHGMVDKLDYHSP
NLDNRKPYTYFEEAFPGVVSVALSEEDLWYIHAETDHRWGTTRNDSAAVPLDQGQVGV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
183 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
187 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
190 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
183 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
187 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
190 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
183 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
187 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
190 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

valine cyclopropanase

+ + +
D-valine
27477		 S-adenosyl-L-methioninate
67040		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319		 (+)-(1S,2S)-norcoronamic acid
87174

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:08 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 466 469
July 15, 2014, 6:19 a.m. update domain start position 1 2
Aug. 15, 2014, 5:23 a.m. update curation agent setDomainBoundaries.py holliday
Oct. 16, 2014, 6:47 a.m. update curation agent holliday setDomainBoundaries.py
Aug. 14, 2015, 1:24 p.m. update domain end position 469 478
update domain start position 2 1
Oct. 15, 2016, 6:31 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update name Putative uncharacterized protein Swb7 valine cyclopropanase (Swb7)
EC number assigned by UniProtKB accession ID.