Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup SPASM/twitch domain containing
⌊ main SPASM domain-containing
⌊ cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ Family cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ FunctionalDomain Molybdenum cofactor biosynthesis protein (ID 419056)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
Family Assignment Evidence Code | ISS |
This entry was last updated on | Feb. 6, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Staphylococcus aureus subsp. aureus 21259 Taxon ID: 904744 | 341846872 | EGS88060.1 (Genbank) | URP |
obsolete GIs = 417898943, 487722491 |
Length of Enzyme (full-length): 263 | Length of Functional Domain: 263
MMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQS
INNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFM
DVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVS
QSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYS
DERTAQTVANRQRKKINMNYIGG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.