Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup SPASM/twitch domain containing
⌊ main SPASM domain-containing
⌊ cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ Family cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ FunctionalDomain Molybdenum cofactor biosynthesis protein (ID 418246)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | Feb. 6, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus Taxon ID: 1280 | 487714519 | WP_001798751.1 (RefSeq) | URP |
| Staphylococcus aureus subsp. aureus D139 Taxon ID: 585152 | 282318576 | EFB48934.1 (Genbank) | URP |
| obsolete GI = 282917614 | |||
Length of Enzyme (full-length): 217 | Length of Functional Domain: 217
MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEML
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



