Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  main SPASM domain-containing

  cyclic pyranopterin phosphate synthase (MoaA-like)

     ⌊ Family cyclic pyranopterin phosphate synthase (MoaA-like)

  ⌊ FunctionalDomain Molybdenum cofactor biosynthesis protein (ID 417354)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code ISS
This entry was last updated onFeb. 6, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Staphylococcus aureus MRSA_CVM43477 Taxon ID: 1448137 751816314 KIN25571.1 (Genbank) URP
Staphylococcus aureus 917 Taxon ID: 1338533 744831509 KIE16004.1 (Genbank) URP
Staphylococcus aureus subsp. aureus Taxon ID: 46170 700317691 AIU86196.1 (Genbank) URP
Show All

Sequence

Length of Enzyme (full-length): 309 | Length of Functional Domain: 309

1       10        20        30        40        50        60

MPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLN
QIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQ
IDYATSIGLNVKVNVVIQKGINDDQIIPMLEY
FKDKHIEIRFIEFMDVGNDNGWDFSKVV
TKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSS
DGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQRK
KINMNYIGG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 4/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
44 Gly (G) side chain Binds S-adensosylmethionine
Notes: Acts via the carbonyl group of the backbone
substrate binding -- binding ISS
230 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
233 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
247 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 8/12 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
40 Arg (R) side chain Binds GTP substrate binding -- binding ISS
44 Gly (G) side chain Binds S-adensosylmethionine
Notes: Acts via the carbonyl group of the backbone
substrate binding -- binding ICS PubMed:16632608
95 Ser (S) side chain Binds S-adensosylmethionine substrate binding -- binding ICS PubMed:16632608
132 Lys (K) side chain Binds GTP substrate binding -- binding ISS
166 Met (M) side chain Binds S-adensosylmethionine
Notes: Acts via both the amide and carbonyl groups of the backbone.
substrate binding -- binding ICS PubMed:16632608
230 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
233 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
247 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
2FB3 Structure Of Moaa In Complex With 5'-Gtp Molybdenum Cofactor Biosynthesis Protein A 49 2.35 Sulfate Ion
(5 more ⇓)
CSA • PDB • PDBSum
1TV7 Structure Of The S-Adenosylmethionine Dependent Enzyme Moaa Molybdenum Cofactor Biosynthesis Protein A 49 2.8 Sulfate Ion • Iron/Sulfur Cluster CSA • PDB • PDBSum
1TV8 Structure Of Moaa In Complex With S-Adenosylmethionine Molybdenum Cofactor Biosynthesis Protein A 49 2.2 Sulfate Ion
(3 more ⇓)
CSA • PDB • PDBSum
2FB2 Structure Of The Moaa Arg17/266/268/Ala Triple Mutant Molybdenum Cofactor Biosynthesis Protein A 48 2.25 Yes Sulfate Ion
(2 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Oct. 15, 2016, 6:24 a.m. update family assignment evidence code IEA ISS
update name uncharacterized Radical SAM superfamily sequence Molybdenum cofactor biosynthesis protein
update subgroup SPASM/twitch domain containing cyclic pyranopterin phosphate synthase (MoaA-like)
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.