Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

  ⌊ methyltransferase (Class B)

     ⌊ Family tryptophan 2-C-methyltransferase

  ⌊ FunctionalDomain TsrM (ID 412830)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:19246004 PubMed:19265401 PubMed:26456915
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces laurentii Taxon ID: 39478 225055396 ACN80682.1 (Genbank)
Streptomyces laurentii Taxon ID: 39478 224495618 ACN52303.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
Tryptophan 2-C-methyltransferase {ECO:0000305} C0JRZ9 TSRM_STRLU (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 599 | Length of Functional Domain: 598

1       10        20        30        40        50        60

MLRKGTVALINPNQIHPPIAPYALDVLTTALEASGFEAHVLDLTFHLDDWRQTLRDYFRA
ERPLLVGVTCRNTDTVYALEQRPFVDGYKAVIDEVRRLTAAPVVAGGVGFSTMPFALVDY
FGIEYGVKGPGEKIICDLARALAEGRSADRIHIPGLLVNRGPGNVTRVAPPALDPRAAPA
PSSSPSPSPAPSSSSAPVPVPLSFAAVGHHESRAWQAETELPYTRRSGEPYKVDNLRYYR
EGGLGSILTKNGCVYKCSFCVEPDAKGTQFARRGITAVVDEMEALTAQGIHDLHTTDSEF
NLSIAHSKNLLREIVRRRDHDATSPLRDLRLWVYCQPSPFDEEFAELLAAAGCAGVNIGA
DHTRPEMLDGWKVTAKGTRYYDFADTERLVQLCHRNGMLTMVEALFGMPGETLETMRDCV
DRMMELDATVTGFSLGLRLLPYMGLAKSLAEQCDGVRTVRGLQSNNASGPIVLKQLHQCD
GPIEYERQFMFDESGDFRLVCYFSPDLPEAPGTADSPDGIWRASVDFLWDRIPKSEQYRV
MLPTLSGSSENDNNYADNPFLTSLNRKGYTGAFWAHWRDREAIMSGATLPLGELAEAVR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
253 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
257 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
260 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
253 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
257 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
260 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
253 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
257 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
260 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

tryptophan 2-C-methyltransferase

+ 2 + + +
L-tryptophan zwitterion
57912		 S-adenosyl-L-methioninate
67040		 2-methyl-L-tryptophan zwitterion
85908		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:03 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 451 599
update domain start position 4 3
Oct. 15, 2016, 6:12 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 599 598
update domain start position 3 1
EC number assigned by UniProtKB accession ID.