Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 407927)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 487737910 | WP_001821784.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Thompson str. ATCC 8391 Taxon ID: 935705 | 820765650 | AKG82519.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Enteritidis Taxon ID: 149539 | 808226868 | KKD72988.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 Taxon ID: 941187 | 554253320 | ESG89776.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Paratyphi B str. SARA42 Taxon ID: 1029977 | 554125511 | ESF66293.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Thompson str. RM6836 Taxon ID: 1064551 | 548714334 | AGX09974.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Inverness str. R8-3668 Taxon ID: 913075 | 353606783 | EHC60916.1 (Genbank) | URP |
| obsolete GIs = 417371901, 549478768, 554067324 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | G5N9W2 | G5N9W2_SALET (TrEMBL) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MARHPRWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWRNPHERDMPYLEQIVQGV
KAMGLETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
REAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDK
DLQLFRKLGLNPQQTRVLAGDNEQQQRLEQTLMTPDTDDYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



