Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 407864)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 620 | 446873952 | WP_000951208.1 (RefSeq) | |
| Shigella boydii 965-58 Taxon ID: 766138 | 391270115 | EIQ29012.1 (Genbank) | URP |
| Shigella dysenteriae 155-74 Taxon ID: 766142 | 332091163 | EGI96253.1 (Genbank) | URP |
| Shigella boydii 5216-82 Taxon ID: 766141 | 332089015 | EGI94127.1 (Genbank) | URP |
| Shigella boydii ATCC 9905 Taxon ID: 932676 | 320178485 | EFW53450.1 (Genbank) | URP |
| Shigella dysenteriae 1012 Taxon ID: 358708 | 194416768 | EDX32895.1 (Genbank) | URP |
| obsolete GIs = 417690345, 417672953, 416286825, 194434986, 420347974 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | I6DB70 | I6DB70_SHIBO (TrEMBL) | |
| n/a | F5MDV5 | F5MDV5_SHIDY (TrEMBL) | |
| n/a | E7T3B1 | E7T3B1_9ENTR (TrEMBL) | |
| n/a | A0A1S9K6A1 | A0A1S9K6A1_SHIDY (TrEMBL) | |
| n/a | B3X6H2 | B3X6H2_9ENTR (TrEMBL) | |
| n/a | F5MEP1 | F5MEP1_9ENTR (TrEMBL) | |
| Show All | |||
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV
KAMGLEACMTLGTLSESQAQRLADAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLITPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



