Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 407755)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli A35218R Taxon ID: 1269009 | 553720090 | ESE35016.1 (Genbank) | URP |
| Escherichia coli MS 60-1 Taxon ID: 749530 | 324011079 | EGB80298.1 (Genbank) | URP |
| Escherichia coli MS 200-1 Taxon ID: 749550 | 300305377 | EFJ59897.1 (Genbank) | URP |
| obsolete GIs = 422377608, 300992214, 485702513 | |||
Length of Enzyme (full-length): 338 | Length of Functional Domain: 315
MSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKT
GLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPRERDMPYLEQMVQGVKAMGLEAC
MTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGIKVC
SGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIA
VARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKL
GLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



