Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 407513)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Shigella flexneri Taxon ID: 623 | 446873958 | WP_000951214.1 (RefSeq) | URP |
| Shigella flexneri Taxon ID: 623 | 721539426 | KGY82782.1 (Genbank) | URP |
| Shigella flexneri K-1770 Taxon ID: 766153 | 391258125 | EIQ17231.1 (Genbank) | URP |
| Shigella flexneri 2850-71 Taxon ID: 766158 | 391253462 | EIQ12635.1 (Genbank) | URP |
| Shigella flexneri J1713 Taxon ID: 754092 | 335576603 | EGM62848.1 (Genbank) | URP |
| Shigella flexneri K-227 Taxon ID: 766147 | 333020426 | EGK39689.1 (Genbank) | URP |
| Shigella flexneri K-272 Taxon ID: 766148 | 333009761 | EGK29210.1 (Genbank) | URP |
| Shigella flexneri VA-6 Taxon ID: 766145 | 333006893 | EGK26389.1 (Genbank) | URP |
| obsolete GIs = 420330079, 420319274, 417826835, 417716206, 417711381, 417706383 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | F5MZE7 | F5MZE7_SHIFL (TrEMBL) | |
| n/a | F5NS45 | F5NS45_SHIFL (TrEMBL) | |
| n/a | I6BZE3 | I6BZE3_SHIFL (TrEMBL) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV
KAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLGQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



