Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup muconate cycloisomerase

  ⌊ muconate cycloisomerase (syn) like

  ⌊ FunctionalDomain Uncharacterized (chloro)muconate cycloisomerase (syn) like subgroup sequence (ID 403)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Cupriavidus necator Taxon ID: 106590 695196724 YP_009074183.1 (RefSeq) URP
Taxon ID: 106589 499491745 WP_011178385.1 (RefSeq)
Ralstonia eutropha JMP134 Taxon ID: 264198 72123620 AAZ65763.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Chloromuconate cycloisomerase P05404 5.5.1.7 TFDD1_CUPNJ (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 370 | Length of Functional Domain: 370

1       10        20        30        40        50        60

MKIDAIEAVIVDVPTKRPIQMSITTVHQQSYVIVRVYSEGLVGVGEGGSVGGPVWSAECA
ETIKIIVERYLAPHLLGTDAFNVSGALQTMARAVTGNASAKAAVEMALLDLKARALGVSI
AELLGGPLRSAIPIAWTLASGDTKRDLDSAVEMIERRRHNRFKVKLGFRSPQDDLIHMEA
LSNSLGSKAYLRVDVNQAWDEQVASVYIPELEALGVELIEQPVGRENTQALRRLSDNNRV
AIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQKIAAVAEASGIASYGGTMLD
STIGTSVALQLYSTVPSLPFGCELIGPFVLADTLSHEPLEIRDYELQVPTGVGHGMTLDE
DKVRQYARVS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
194 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
220 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
245 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 7/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
163 Lys (K) side chain Electrostatic stabilization of transition state electrostatic stabiliser -- spectator ISS PubMed:10336378
165 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:10336378
194 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:9724714
220 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:9724714
245 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:9724714
269 Lys (K) side chain Stabilizes enolate anion intermediate electrostatic stabiliser -- spectator ICS PubMed:19220063
323 Glu (E) side chain general acid proton relay -- reactant ICS PubMed:7500361

Catalyzed Reaction

3-chloromuconate cycloisomerase (non-dehalogenating)

+
(2-chloro-5-oxo-2,5-dihydro-2-furyl)acetate
58109		 3-chloro-cis,cis-muconate(2-)
17589		 hydron
15378

EC: 5.5.1.7 | IntEnz: 5.5.1.7 | Kegg: 5.5.1.7 | BioCyc: 5.5.1.7 | BRENDA: 5.5.1.7

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
2CHR A Re-Evaluation Of The Crystal Structure Of Chloromuconate Cycloisomerase Chloromuconate Cycloisomerase 2 3.0 Manganese (Ii) Ion • Chloride Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Nov. 3, 2014, 2:33 a.m. update curation agent sbrown setDomainBoundaries.py
Aug. 10, 2015, 3:02 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
Oct. 15, 2015, 3:26 a.m. update curation agent setDomainBoundaries.py sbrown
remove family assignment evidence code CFM -
remove family chloromuconate cycloisomerase -
update name chloromuconate cycloisomerase Uncharacterized (chloro)muconate cycloisomerase (syn) like subgroup sequence
update subgroup muconate cycloisomerase muconate cycloisomerase (syn) like
Feb. 10, 2017, 3:01 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.