Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 401841)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
Family Assignment Evidence Code | ISS |
This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Escherichia albertii Taxon ID: 208962 | 446873963 | WP_000951219.1 (RefSeq) | URP |
Escherichia albertii KF1 Taxon ID: 1440052 | 569536298 | AHE58605.1 (Genbank) | URP |
Escherichia albertii TW07627 Taxon ID: 502347 | 170122136 | EDS91067.1 (Genbank) | URP |
Escherichia albertii NBRC 107761 Taxon ID: 1115511 | 689833504 | URP | |
obsolete GIs = 458894076, 458752235, 170769064 | |||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | B1EP27 | B1EP27_ESCAT (TrEMBL) | |
n/a | W0AQ04 | W0AQ04_9ESCH (TrEMBL) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV
KAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
REAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAATL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.