Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 401799)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli A25922R Taxon ID: 1269008 | 553715709 | ESE30782.1 (Genbank) | URP |
| Escherichia coli 908675 Taxon ID: 1269004 | 553696960 | ESE12837.1 (Genbank) | URP |
| Escherichia coli 908519 Taxon ID: 1268991 | 553617887 | ESD37690.1 (Genbank) | URP |
| Escherichia coli 907892 Taxon ID: 1268990 | 553613913 | ESD33968.1 (Genbank) | URP |
| Escherichia coli 907391 Taxon ID: 1268980 | 553574926 | ESC96573.1 (Genbank) | URP |
| Escherichia coli MS 57-2 Taxon ID: 749529 | 324009639 | EGB78858.1 (Genbank) | URP |
| Escherichia coli MS 16-3 Taxon ID: 749542 | 315299294 | EFU58546.1 (Genbank) | URP |
| Escherichia coli MS 153-1 Taxon ID: 749541 | 315292633 | EFU51985.1 (Genbank) | URP |
| Escherichia coli MS 110-3 Taxon ID: 749536 | 315287200 | EFU46612.1 (Genbank) | URP |
| Escherichia coli MS 45-1 Taxon ID: 749528 | 300406658 | EFJ90196.1 (Genbank) | URP |
| Escherichia coli MS 185-1 Taxon ID: 749546 | 300297066 | EFJ53451.1 (Genbank) | URP |
| obsolete GIs = 422379102, 422368952, 422364680, 422358988, 301051307, 300993250, 485693999 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | V0V3A5 | V0V3A5_ECOLX (TrEMBL) |
Length of Enzyme (full-length): 338 | Length of Functional Domain: 315
MSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKT
GLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEAC
MTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGIKVC
SGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIA
VARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKL
GLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



