Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup 7-carboxy-7-deazaguanine synthase like

     ⌊ Family 7-carboxy-7-deazaguanine synthase, Cx14CxxC type

  ⌊ FunctionalDomain uncharacterized 7-carboxy-7-deazaguanine synthase CX14CX2C-like sequence (ID 395868)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Burkholderia cenocepacia Taxon ID: 95486 497381513 WP_009695726.1 (RefSeq) URP
Burkholderia cenocepacia Taxon ID: 95486 685644518 AIO31652.1 (Genbank) URP
Burkholderia sp. TJI49 Taxon ID: 987057 325518103 EGC97893.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A132EF43 A0A132EF43_9BURK (TrEMBL)
n/a A0A088U5E6 A0A088U5E6_9BURK (TrEMBL)
n/a F0GKT5 F0GKT5_9BURK (TrEMBL)

Sequence

Length of Enzyme (full-length): 210 | Length of Functional Domain: 210

1       10        20        30        40        50        60

MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN
GGKFKDADALVATIAGLWPDGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNGS
LPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSR
DLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 2/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
46 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
49 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 5/5 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
46 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
49 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
50 Asp (D) side chain Activates Mg(II) binding residue activation -- spectator IEA
51 Thr (T) side chain Binds Mg(II) ion metal ligand -- binding IEA
Family CAR This EFD conserves 8/8 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
25 Phe (F) side chain Binds substrate substrate binding -- binding ICS PubMed:24362703
31 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ICS PubMed:24362703
46 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ICS PubMed:24362703
49 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ICS PubMed:24362703
50 Asp (D) side chain Activates metal binding Thr activation -- spectator ICS PubMed:24362703
51 Thr (T) side chain Binds Mg(II) ion metal ligand -- binding ICS PubMed:24362703
116 Glu (E) side chain General acid/base proton relay -- reactant ICS PubMed:24362703
204 His (H) side chain Binds substrate substrate binding -- binding ICS PubMed:24362703

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4NJK Crystal Structure Of Quee From Burkholderia Multivorans In Complex With Adomet, 7-Carboxy-7-Deazaguanine, And Mg2+ 7-Carboxy-7-Deazaguanine Synthase 14 1.91 Iron/Sulfur Cluster
(5 more ⇓) 		CSA • PDB • PDBSum
4NJJ Crystal Structure Of Quee From Burkholderia Multivorans In Complex With Adomet, 6-Carboxy-5,6,7,8-Tetrahydropterin, And Manganese(Ii) 7-Carboxy-7-Deazaguanine Synthase 14 2.7 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4NJI Crystal Structure Of Quee From Burkholderia Multivorans In Complex With Adomet, 6-Carboxy-5,6,7,8-Tetrahydropterin, And Mg2+ 7-Carboxy-7-Deazaguanine Synthase 14 2.2 Iron/Sulfur Cluster
(5 more ⇓) 		CSA • PDB • PDBSum
4NJH Crystal Structure Of Quee From Burkholderia Multivorans In Complex With Adomet And 6-Carboxy-5,6,7,8-Tetrahydropterin 7-Carboxy-7-Deazaguanine Synthase 14 1.9 Iron/Sulfur Cluster
(4 more ⇓) 		CSA • PDB • PDBSum
4NJG Crystal Structure Of Quee From Burkholderia Multivorans In Complex With Adomet And 6-Carboxypterin 7-Carboxy-7-Deazaguanine Synthase 14 2.6 Iron/Sulfur Cluster
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Oct. 16, 2014, 5:50 a.m. update curation agent holliday setDomainBoundaries.py
Aug. 14, 2015, 12:06 p.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update name Uncharacterised Radical SAM sequence uncharacterized 7-carboxy-7-deazaguanine synthase CX14CX2C-like sequence
update superfamily assignment evidence code ISS IEA
EC number assigned by UniProtKB accession ID.