Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

     ⌊ Family OxsB-like

  ⌊ FunctionalDomain OxsB protein (ID 395718)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:22172915
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Bacillus megaterium Taxon ID: 1404 2281787 URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a O24770 O24770_BACME (TrEMBL)

Sequence

Length of Enzyme (full-length): 744 | Length of Functional Domain: 744

1       10        20        30        40        50        60

MQTYLSTKSIEYYLKELKEIFSQIWLKPSEIEKRCEELFKRSKEFDYKRILVSGETDNTT
LYVIEDSSKIHVFSPNRDLRENPLLMRWHPSWYEIESKEIYYKCFLSCEELYEHLELPTV
TLVNLCVIENFPIPRLNLSTGTLSSYLRKEQLAKVELIDMQVGTTINQIIKNLLDSQPDI
IGLSVNFGQKKLAFEILDLIYSHIENGDLSSIITVGNVIPSFSPEQFFERYPSLLICDKE
GEYTLRDLIKMLKKELKLDEVNGISYVDESGEVKHNVAETVNFKEEVPTPSLDILGEISK
FRGALTLETSRGCDYSRCTFCPRDHKLRSWRPLSVEQTLKQLDDILRAGKHFNIKPHIYM
ADEEFIGELPNGTEAQRIIDICEGLLKREEKIKFDFAARADSVYEPKRTKEWNVERLKMW
HYCALAGADRIFIGVESGSNQQLKRYGKGTTSEQNIIALRLVSALGINLRIGFIMFDQLM
KGLDNLKENLDFLERTDALMKPIDIGDMTYEELYDKLLNDKEFIEKHKTGKPVYTIVSYM
LASMEILMNTPYSRMVQLTERKEEVNLIMNDGKPDMNMGRYATSFVDKTNGNLSEACQMW
IDSNFGVMYTIKSLHKVANPREKKKLYSYMETHREISHFLLKYLVYNLSPDKESQIILSD
FLRMHSMEHILDNSKINVGDGSKENILNVMTNWQLIMEKLLRDVEADLNKGIITDSEDHR
LHNTLKRWFSDMGNWSLINAYELN
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
313 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
318 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
321 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
313 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
318 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
321 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
313 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
318 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
321 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

oxsB

AMP(2-)
456215		 oxetanocin A 4-phosphate(2-)
85720

EC: 5.-.-.- | IntEnz: 5.-.-.- | Kegg: 5.-.-.- | BioCyc: 5.-.-.- | BRENDA: 5.-.-.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:39 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 529 713
update domain start position 119 6
July 15, 2014, 5:36 a.m. update domain end position 713 674
update domain start position 6 74
Oct. 15, 2016, 5:33 a.m. update domain end position 674 744
update domain start position 74 1
EC number assigned by UniProtKB accession ID.