Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ main SPASM domain-containing

  ⌊ thioether bond formation requiring two auxiliary iron-sulfur clusters

     ⌊ Family Tte1186a maturase

  ⌊ FunctionalDomain Tte1186a maturase (ID 395017)

Superfamily Assignment Evidence Code(s) ISS PubMed:27007615
Family Assignment Evidence Code CFM PubMed:27007615
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Caldanaerobacter subterraneus Taxon ID: 911092 499335029 WP_011025521.1 (RefSeq) URP
Thermoanaerobacter tengcongensis MB4 Taxon ID: 273068 20516186 AAM24417.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q8RAM6 Q8RAM6_CALS4 (TrEMBL)

Sequence

Length of Enzyme (full-length): 469 | Length of Functional Domain: 469

1       10        20        30        40        50        60

MSATMHKFKRLGLNIVVDPVSGAIHVVDDVVYDVLDYYENHSREEIVNLLKDKYKEEDIL
EAISEVDELKGNGLLFTEDIYKDIAISRADSVIKAMCLNVAHDCNLRCKYCFASTGNFKG
GRKLMDFETGRKAIDFLIKSSGKRRNIEIDFFGGEPLLNFEVVKQLVEYGKQKAKENKKN
IKFTITTNAVLLDDEKIEYFNENFSNVVLSLDGRKEVNDQMRVRADGSGTYDVIVPKIQK
FVKARGKKEYYVRGTFTAKNLDFVEDVLHIADLGVYEISVEPVVEKDDKDYTLKEEHLDR
IFEEYDRLAEEYIRRYEEGRPFAFYHFKIDLKGGPCIKKRLQGCGAGFEYIAVTPDEEIY
PCHQFVGIEEFKLGTLDEGITNIELQRKFMESDIYKREECANCWARFYCSGGCFANNYNI
NGDINKPYKLACEMQKRRIENAIAIKAYLTLRGEKGDYQRVQRDKAANR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
104 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
108 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
111 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
104 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
108 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
111 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 10/10 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
104 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IMP PubMed:27007615
108 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IMP PubMed:27007615
111 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IMP PubMed:27007615
344 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 1 metal ligand -- binding IMP PubMed:27007615
362 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 1 metal ligand -- binding IMP PubMed:27007615
400 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 2 metal ligand -- binding IMP PubMed:27007615
403 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 2 metal ligand -- binding IMP PubMed:27007615
409 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 2 metal ligand -- binding IMP PubMed:27007615
413 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 1 metal ligand -- binding IMP PubMed:27007615
432 Cys (C) side chain Binds [4Fe-4S] auxillary cluster 2 metal ligand -- binding IMP PubMed:27007615

Catalyzed Reaction

thioether cross-link between Cys and Thr

+ + + +
cysteine residue
32460		 L-threonine residue
30013		 S-adenosyl-L-methionine zwitterion
59789		 Cys-Thr thioether
132254		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
Oct. 16, 2014, 5:47 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 5:31 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update family assignment evidence code IEA CFM
update family quinohemoprotein amine dehydrogenase maturation protein (QhpD-like) Tte1186a maturase
update name Quinohemoprotein amine dehydrogenase maturation protein Tte1186a maturase
update subgroup dehydrogenase like thioether bond formation requiring two auxiliary iron-sulfur clusters
EC number assigned by UniProtKB accession ID.