Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup organic radical-activating enzymes

  activating enzymes, group 2

     ⌊ Family pyruvate formate-lyase activase

  ⌊ FunctionalDomain uncharacterized Radical SAM superfamily sequence (ID 394711)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Salmonella enterica subsp. enterica serovar Cubana str. 76814 Taxon ID: 1192560 564140861 ETA86294.1 (Genbank) URP
Salmonella enterica subsp. enterica serovar Infantis str. SARB27 Taxon ID: 596155 353075369 EHB41129.1 (Genbank) URP
Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1 Taxon ID: 936157 320085207 URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a G4C0C4 G4C0C4_SALIN (TrEMBL)
n/a V7ILV6 V7ILV6_SALET (TrEMBL)

Sequence

Length of Enzyme (full-length): 292 | Length of Functional Domain: 245

1       10        20        30        40        50        60

MQPPYQGAQHARNVSINPMLFRASRSDMSNLTDCITNESVAVTADKKPVIGRIHSFESCG
TVDGPGIRF
ITFFQGCLMRCLYCHNRDTWDTHGGKEITVEDLMKEVVTYRHFMNASGGGV
TASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLDVTDLVMLDLKQM
NDEIHQNLVGVSNHRTLEFAQYLSKKNVKVWIRYVVVPGWSDDD
DSAHRLGEFTRDMGNV
EKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMY
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
76 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
80 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
83 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
76 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
80 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
83 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
76 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
80 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
83 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3C8F 4Fe-4S-Pyruvate Formate-Lyase Activating Enzyme With Partially Disordered Adomet Pyruvate Formate-Lyase 1-Activating Enzyme 148 2.25 Iron/Sulfur Cluster
(2 more ⇓)
CSA • PDB • PDBSum
3CB8 4Fe-4S-Pyruvate Formate-Lyase Activating Enzyme In Complex With Adomet And A Peptide Substrate Pyruvate Formate-Lyase 1-Activating Enzyme • Peptide Substrate Vsgyav 148 2.77 Sodium Ion
(3 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
May 14, 2014, 3:37 a.m. update curation agent holliday setDomainBoundaries.py
update domain start position 1 48
EC number assigned by UniProtKB accession ID.