Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup muconate cycloisomerase

  ⌊ muconate cycloisomerase (syn) like

  ⌊ FunctionalDomain 3-chloromuconate cycloisomerase (ID 39222)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Pseudomonas reinekei Taxon ID: 395598 134133936 ABO61025.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a C6YXG6 C6YXG6_9PSED (TrEMBL)

Sequence

Length of Enzyme (full-length): 377 | Length of Functional Domain: 375

1       10        20        30        40        50        60

MSQGFVIGRVLAQRLDIPFSQPIRMSFGTLDRLNLLLVRLIDENGIEGVGEATVMGGPYW
GGESIEAVEAAVVKYLGPQLIGQRFRGLEEFSYRLSKTVKGNAAARSALEMAAFDLVGKQ
LGVSASALLGGRCRDRLQVAWTLSTGSEGGDIAEGERAIQARGHTRFKLKFGSGDPDAEL
LRVAGIAEAFRGRASIILDINQGWDLGTALRYFPVLEEAGVECIEQPLAALDLHGAARLK
ASTSMEIIADEVLTDLRSAFEVATANAASAVSLKPNRDGGMLAAKRVATVASASGLKIYG
GTALESSLGTAASALIYASLPSLQLGTELFGPLRLQADIVKAPLLPIDGHLDVPTGEGLG
VVLDEDLIRSLSVDVLH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
199 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
225 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
250 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 7/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
168 Lys (K) side chain Electrostatic stabilization of transition state electrostatic stabiliser -- spectator ISS PubMed:10336378
170 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:10336378
199 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:9724714
225 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:9724714
250 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:9724714
274 Lys (K) side chain Stabilizes enolate anion intermediate electrostatic stabiliser -- spectator ICS PubMed:19220063
328 Glu (E) side chain general acid proton relay -- reactant ICS PubMed:7500361

Catalyzed Reactions

3-chloromuconate cycloisomerase (dehalogenating, to dienelactone)

+
3-chloro-cis,cis-muconate(2-)
17589		 4-carboxymethylenebut-2-en-4-olide
11972		 hydrogen chloride
17883

EC: 5.5.1.- | IntEnz: 5.5.1.- | Kegg: 5.5.1.- | BioCyc: 5.5.1.- | BRENDA: 5.5.1.- |

3-chloromuconate cycloisomerase (dehalogenating, to protoanemonin)

+ +
3-chloro-cis,cis-muconate(2-)
17589		 protoanemonin
28906		 carbon dioxide
16526		 chloride
17996

EC: 5.5.1.- | IntEnz: 5.5.1.- | Kegg: 5.5.1.- | BioCyc: 5.5.1.- | BRENDA: 5.5.1.- |

Curation History
Time Change Annotation Old Value New Value
April 30, 2014, 2:31 a.m. update curation agent updateSFLD2.py setDomainBoundaries.py
update domain end position 376 374
update domain start position 7 2
Aug. 10, 2015, 3:11 a.m. update domain start position 2 1
Oct. 15, 2015, 3:35 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
update domain end position 374 375
remove family assignment evidence code IEA -
remove family o-succinylbenzoate synthase -
update name o-succinylbenzoate synthase 3-chloromuconate cycloisomerase
update subgroup muconate cycloisomerase muconate cycloisomerase (syn) like
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.