Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

  ⌊ methyltransferase (Class B)

     ⌊ Family fortimicin-like methyltransferase

  ⌊ FunctionalDomain Fortimicin KL1 methyltransferase (ID 391614)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:7490235
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Micromonospora olivasterospora Taxon ID: 1880 1125024

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q50258 Q50258_MICOL (TrEMBL)

Sequence

Length of Enzyme (full-length): 553 | Length of Functional Domain: 553

1       10        20        30        40        50        60

MSTRTDTGVTRVLLIKPPIRACMIEIGRHMPIGLAYLAAQLRNSGMEVDIFDSLAFSEDN
HVVPPSQYTDIDRAKVAAHPRWDHLVHWGADWARVEQVLRRGYDVVGVSCMFTPYYEPAY
ELGRLAKQILPQARVILGGQHPTVAHPHALAEEAFDALVLGEAEANVVEIVEALAAGRSL
RGMPGLTFRCGTGLCDCPRPSGVHLQPRAEFLQDLDGLALPAVDLLDMGSYDETATLITS
RGCPFSCSFCTVHATVGKKFRARAPENVVDEIEHYVTEHGIRRFFIEDDNFTFDIARVHE
ICRAITRRGLDVELHLPNGMTVVKLDKPLVDDMAAAGFQSLFLGLETTDVKRLRQIRKGF
TSLEKVNAGAGLFTDHGITVGASLIVGLLGQTPAEVARDSINLMLAGIRFWTNPFYPIPG
SPDFQQCLANGLITHDTELALYDQFNFAIGSDHLSPAELYWSVVITQAMAHWPDYVLEGA
RVRRERGTVGLDEALQRLLAHSDSLFGPNGELEVPAVPRRSTATSCTATRRLLPRGAAHQ
PAATARRGLHLHR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
243 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
247 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
250 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
243 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
247 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
250 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
243 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
247 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
250 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

fortimicin KL1 methyltransferase

+ 2 + + +
Fortimicin KL1
81424		 Bacteriochlorophyll d
81553		 fortimicin KK1
86409		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:36 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 545 553
EC number assigned by UniProtKB accession ID.