Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

  ⌊ methyltransferase (Class B)

     ⌊ Family carbapenem intermediate methyltransferase (ThnK-like)

  ⌊ FunctionalDomain Methyltransferase ThnK (ID 391536)

Superfamily Assignment Evidence Code(s) ISS PubMed:12725858
Family Assignment Evidence Code CFM PubMed:12725858
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces cattleya Taxon ID: 29303 503917289 WP_014151283.1 (RefSeq)
Streptomyces cattleya NRRL 8057 Taxon ID: 1003195 365810883 AEW99098.1 (Genbank) URP
Streptomyces cattleya NRRL 8057 Taxon ID: 1003195 337763148 URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q83XP3 Q83XP3_STRCT (TrEMBL)
n/a F8JND9 F8JND9_STREN (TrEMBL)

Sequence

Length of Enzyme (full-length): 681 | Length of Functional Domain: 680

1       10        20        30        40        50        60

MTVPAARSGRKVYFIGLNAVPFLPLVAGLLRTYAEQDPRVAAGYDFQEPVFLVDGVQEMA
AGITDPDVLALSCYVWNFRRQMKVARLVKERHPGMLVVAGGPHVPDRPGDFFARHPYVDV
LVHGEGETAFRELLIERLADHPDYTRVPGVSVRHGTEAVPGRPAERLPRRIETPSPYLLG
VMDGAVATCRQRDLRFYALWETNRGCPYSCAFCDWGSATMSALRLFDAERLQEEIEWFAE
HDVEDLFVCDANFGILPRDLEIARALADARAATGAPKLIRVNFAKNSNDRVFEISKTWHD
ADLLMGTTLSMQSTDLDVLEAIDRKNIGLENYRKLQQRYATENIHTYTELILGLPLESPR
SFRDGIGSLLEAGNHEDIRVYEFGILPNAPINTPEKIAGYGLRTVPKRLYVEEPGTPDDE
AETVDMVMETNAMSRDEWVDCFGFVQAVQFLHNGCYTRYLSMYLRQRHDIGYTAFYERLQ
QYFGARPDTVLGSIYLRMRKLYHDYIDIPELPLANLVASQPDMAADLARYGKRRGWTIDN
WGWLRIANDFERTYTELRDFVAALGVDDTSDPDLAEVFRFQQDVMLRPDYDPAAGRTTEY
TADWPGYFTTGELRRRPVRMRLADQRFGANGRYTPVPGDLKAFARAAIGPSYPVSRIGHY
RHRFEAAEVTSPAEPVLTEQR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
213 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
213 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
213 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reactions

carbapenem intermediate methyltransferase, second methyltransferase

+ 2 + + +
carbapenem biosynthesis intermediate 2
132290		 S-adenosyl-L-methionine zwitterion
59789		 carbapenem biosynthesis intermediate 5
132289		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319		 S-adenosyl-L-homocysteine zwitterion
57856

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

carbapenem intermediate methyltransferase, first methyltransferase

+ 2 + + +
carbapenem biosynthesis intermediate 1
132304		 S-adenosyl-L-methioninate
67040		 carbapenem biosynthesis intermediate 2
132290		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:36 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 414 679
July 15, 2014, 7:05 a.m. update classification public staff
update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 679 681
update domain end position 681 679
update superfamily assignment evidence code ISS IEA
Aug. 15, 2014, 4:44 a.m. update classification staff public
update curation agent setDomainBoundaries.py holliday
update superfamily assignment evidence code IEA ISS
Oct. 16, 2014, 5:40 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 5:26 a.m. update domain end position 679 681
update domain start position 1 2
EC number assigned by UniProtKB accession ID.