Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

  ⌊ methyltransferase (Class B)

     ⌊ Family gentamicin C-6' methyltransferase (GenK-like)

  ⌊ FunctionalDomain Gentamicin C-methyltransferase (ID 391409)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:23679096
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Micromonospora echinospora Taxon ID: 1877 41019299 AAR98557.1 (Genbank)
Micromonospora echinospora Taxon ID: 1877 85814024
Micromonospora echinospora Taxon ID: 1877 45544467

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q70KE5 Q70KE5_MICEC (TrEMBL)

Sequence

Length of Enzyme (full-length): 638 | Length of Functional Domain: 638

1       10        20        30        40        50        60

MNALVAAPSVTEGNQVKVFLVKPPIRGCMVEIGRHVPIGLAYVSSALRAAGHETEIFDSL
AYTEDNHVVPDAELTTIERAKLERHPRWRHIMHWGARTERIEAALAASEADVVGISCMFT
PYYESAYELARMAKRVLPNAKVIVGGQHGTVAFPHVLEVPEVDAVMLGEAEVTTVALLDA
FATGRPLTELLGVAFRCGEGLCECATPGTPHIRPRAPFVADLDSLAPPAADQLDFDRYGN
AVTLITSRGCPFSCSFCTVHATVGKQFRARDPQRVVDEIEHYVNVHGVRRFLVEDDNFTF
DIERVHAICQEIVRRKLDVRLSLPNGMTVVKLTEDLVESMVSAGFDDLFLGLETTDAARL
RKMRKGFTSLDKVSAGVALFEKFGLTASAAIIVGLPDQSLDAIVQDAVNLVLAGVEFWTN
PFYPIYGSPDYQTCLTRGIVDPLTDPALFDQFNFAFANGVLAADELYTAWVGTLAMALWP
KYVLEGAERREQGPVSAAEAGARLVEHSMAQLDPESPEELPATVRAIRESADGLLALGHP
LGCVCVMQHVADADKGAGADQFCRFAGDMIAAAIALYSGQPQVSAQVGAQTAGDAEGCSF
MVRPTGDERIGRIQRRFVELLDENRREAELVTAEAVSH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
250 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
254 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
257 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
250 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
254 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
257 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
250 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
254 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
257 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

gentamicin C6 methyltransferase

+ 2 + + +
Gentamicin X2
81280		 S-adenosyl-L-methionine zwitterion
59789		 geneticin
42768		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:35 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 405 561
update domain start position 91 8
Oct. 15, 2016, 5:25 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 561 638
update domain start position 8 1
EC number assigned by UniProtKB accession ID.