Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup muconate cycloisomerase
⌊ FunctionalDomain Uncharacterized Muconate cycloisomerase subgroup sequence (ID 39067)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Bacillus cereus AH1272 Taxon ID: 526993 | 228739390 | EEL89822.1 (Genbank) | URP |
| obsolete GIs = 229021918, 446719468 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | C2Z2G0 | C2Z2G0_BACCE (TrEMBL) |
Length of Enzyme (full-length): 225 | Length of Functional Domain: 225
MAEEAVSMIQKGYQSFKMKVGTNVKEDVKRIEAVRERVGSDIAIRVDVNQGWKNSANTLT
ALRSLGHLNIDWIEQPVIADDIDAMAHIRSKTDLPLMIDEGLKGSREMRQIIKLDAADKV
NIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGP
LKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLQELIVFQDVVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



