Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ Family pyruvate formate-lyase activase
⌊ FunctionalDomain Pyruvate formate-lyase-activating enzyme sequence (ID 389533)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
Family Assignment Evidence Code | IEA |
This entry was last updated on | Jan. 5, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- Taxon ID: 41514 | 160865250 | ABX21873.1 (Genbank) | URP |
obsolete GI = 161503903 |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | A9MHY3 | A9MHY3_SALAR (TrEMBL) |
Length of Enzyme (full-length): 190 | Length of Functional Domain: 190
MKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPV
IDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLSTKNVKVWIRYVVVPGWSD
DDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGI
LEQYGHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.