Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ Family pyruvate formate-lyase activase
⌊ FunctionalDomain Pyruvate formate-lyase-activating enzyme sequence (ID 389292)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
Family Assignment Evidence Code | IEA |
This entry was last updated on | Jan. 5, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Escherichia coli MS 182-1 Taxon ID: 749545 | 300417433 | EFK00744.1 (Genbank) | URP |
obsolete GIs = 300926542, 485692402 |
Length of Enzyme (full-length): 190 | Length of Functional Domain: 190
MKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPV
IDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSD
DDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGI
LEQYGHKVMF
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.