Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 38303)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Feb. 13, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253741 | ACH54205.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253739 | ACH54204.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253737 | ACH54203.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253735 | ACH54202.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253733 | ACH54201.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253731 | ACH54200.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253729 | ACH54199.1 (Genbank) | |
| Saccharomyces cerevisiae Taxon ID: 4932 | 197253727 | ACH54198.1 (Genbank) | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | B5LYQ9 | B5LYQ9_YEASX (TrEMBL) |
Length of Enzyme (full-length): 171 | Length of Functional Domain: 171
YDAIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGT
RDMAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFE
DAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAE
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



