Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup SPASM/twitch domain containing
⌊ main SPASM domain-containing
⌊ cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ Family cyclic pyranopterin phosphate synthase (MoaA-like)
⌊ FunctionalDomain Molybdenum cofactor biosynthesis protein (ID 380855)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus Taxon ID: 1280 | 487757991 | WP_001838204.1 (RefSeq) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 827299372 | KLM89688.1 (Genbank) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 827270374 | KLM60731.1 (Genbank) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 760229571 | KIX75168.1 (Genbank) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 760227323 | KIX73100.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus Mu3 Taxon ID: 418127 | 166217891 | URP | |
| Staphylococcus aureus subsp. aureus Mu3 Taxon ID: 418127 | 156722718 | URP | |
| Staphylococcus aureus subsp. aureus Mu50 Taxon ID: 158878 | 24211997 | URP | |
| Staphylococcus aureus subsp. aureus Mu50 Taxon ID: 158878 | 14248041 | URP | |
| obsolete GIs = 255007046, 15925258, 156980583 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| GTP 3',8-cyclase {ECO:0000255|HAMAP-Rule:MF_01225} | A7X5J1 | MOAA_STAA1 (Swiss-Prot) | |
| GTP 3',8-cyclase {ECO:0000255|HAMAP-Rule:MF_01225} | Q931G4 | MOAA_STAAM (Swiss-Prot) |
Length of Enzyme (full-length): 340 | Length of Functional Domain: 340
MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQELYDAGL
RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



