Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 379057)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 543 | 446873949 | WP_000951205.1 (RefSeq) | |
| Shigella boydii Taxon ID: 621 | 827429256 | AKI65815.1 (Genbank) | URP |
| Escherichia coli Taxon ID: 562 | 763499335 | KIZ68379.1 (Genbank) | URP |
| Shigella flexneri Taxon ID: 623 | 738563513 | KHQ66996.1 (Genbank) | URP |
| Shigella flexneri 1485-80 Taxon ID: 766155 | 404341409 | EJZ67815.1 (Genbank) | URP |
| Shigella boydii 4444-74 Taxon ID: 766140 | 391278340 | EIQ37052.1 (Genbank) | URP |
| Shigella flexneri CCH060 Taxon ID: 754091 | 391256017 | EIQ15156.1 (Genbank) | URP |
| Shigella boydii 3594-74 Taxon ID: 766139 | 332097396 | EGJ02376.1 (Genbank) | URP |
| Shigella flexneri CDC 796-83 Taxon ID: 945360 | 320183264 | EFW58119.1 (Genbank) | URP |
| Shigella boydii CDC 3083-94 Taxon ID: 344609 | 187429166 | ACD08440.1 (Genbank) | URP |
| Shigella boydii Sb227 Taxon ID: 300268 | 81244633 | ABB65341.1 (Genbank) | URP |
| Shigella boydii CDC 3083-94 Taxon ID: 344609 | 254811583 | URP | |
| Shigella boydii Sb227 Taxon ID: 300268 | 123742021 | URP | |
| obsolete GIs = 421681458, 420353585, 420324489, 417680931, 416304654, 82543222, 187732174 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Biotin synthase {ECO:0000255|HAMAP-Rule:MF_01694} | B2TVF5 | BIOB_SHIB3 (Swiss-Prot) | |
| Biotin synthase {ECO:0000255|HAMAP-Rule:MF_01694} | Q324B7 | BIOB_SHIBS (Swiss-Prot) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQVAELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPNERDMPYLEQMVQGV
KDLGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



