Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 378861)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 446012868 | WP_000090723.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum Taxon ID: 594 | 733362700 | KHK47542.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Stanleyville str. CFSAN000624 Taxon ID: 1194159 | 554473920 | ESJ91510.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. 9184 Taxon ID: 685040 | 444848338 | ELX73464.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. SG9 Taxon ID: 909947 | 326627094 | EGE33437.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 Taxon ID: 550538 | 254810800 | URP | |
| Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 Taxon ID: 550538 | 205271834 | URP | |
| obsolete GIs = 445132894, 375122844, 205352053 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Biotin synthase {ECO:0000255|HAMAP-Rule:MF_01694} | B5R761 | BIOB_SALG2 (Swiss-Prot) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MARHPRWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMAVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQIVQGV
KAMGLETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
REAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDK
DLQLFRKLGLNPQQTRVLAGDNEQQQRLEQTLMTPDTDDYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



