Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 376200)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 446028969 | WP_000106824.1 (RefSeq) | URP |
| Escherichia coli 3-073-06_S1_C1 Taxon ID: 1444055 | 652246524 | KDZ52691.1 (Genbank) | URP |
| Escherichia coli O86:H34 str. 99-3124 Taxon ID: 1446762 | 606542531 | EYV96201.1 (Genbank) | URP |
| Escherichia coli TW07793 Taxon ID: 869693 | 386249571 | EII95742.1 (Genbank) | URP |
| obsolete GI = 417287238 | |||
| Show All | |||
Length of Enzyme (full-length): 222 | Length of Functional Domain: 216
MSTPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDL
WYARQPWNGPSRQEVVEQVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLH
MLEKVLTMFDLRDSFDALTSAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIA
SKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTKLTAKDLLG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



