Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.4: 5'-Nucleotidase Like
⌊ FunctionalDomain C1.4: 5'-Nucleotidase Like (ID 35884)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Mus musculus Taxon ID: 10090 | 150261524 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 150261523 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279828 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279827 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279826 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279825 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279824 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279823 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279820 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 93279819 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 82408094 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 82408093 | PRP URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Cytosolic 5'-nucleotidase 3A {ECO:0000305|PubMed:16672222} | Q9D020 | 5NT3A_MOUSE (Swiss-Prot) |
Length of Enzyme (full-length): 297 | Length of Functional Domain: 292
STNQESAVHLKXXPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDXTLSRFSYN
GKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYXVEWYTKSHGL
LIEQGIPKAKLKEIVADSDVXLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGV
YHSNVKVVSNFXDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQ
GDLRXADGVANVEHILKIGYLNDRVDELLEKYXDSYDIVLVKEESLEVVNSILQKTL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



