Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like

  ⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like

  ⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 35090)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Saccharomyces cerevisiae S288c Taxon ID: 559292 398364483 NP_010984.3 (RefSeq) PRP URP
Saccharomyces cerevisiae YJM689 Taxon ID: 1294321 768821880 AJV38442.1 (Genbank) URP
Saccharomyces cerevisiae YJM683 Taxon ID: 1294320 768821622 AJV38185.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Glycerol-1-phosphate phosphohydrolase 2 {ECO:0000305} P40106 GPP2_YEAST (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 250 | Length of Functional Domain: 250

1       10        20        30        40        50        60

MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD
AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD
MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDA
PAGIAAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY
LYAKDDLLKW
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 1/2 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
115 Thr (T) side chain interacts with substrate/intermediate substrate binding -- binding ISS
Subgroup CAR This EFD conserves 2/2 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
18 Asp (D) side chain Mg2+ ligand, nucleophile: attacks phosphate moiety of intermediate to form covalent intermediate covalent catalysis -- reactant,
metal ligand -- binding 		ICS PubMed:12081483
147 Lys (K) side chain None -- ICS PubMed:10956028 PubMed:12081483

Catalyzed Reaction

glycerol-1-phosphatase

+ +
glycerol 1-phosphate(2-)
231935		 water
15377		 glycerol
17754		 hydrogenphosphate
43474

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
April 30, 2014, 6:02 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 246 250
update domain start position 11 1
EC number assigned by UniProtKB accession ID.