Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type I

    ⌊ Subgroup Terpene Cyclase Like 1 C Terminal Domain

  ⌊ Terpene Cyclase Like 1 C Terminal Domain - Enzymatic

  ⌊ FunctionalDomain uncharacterized Terpene Cyclase Like 1 C-term subgroup sequence, Isoprenoid Synthase Type I superfamily (ID 310997)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 19, 2017

Related Enzyme Functional Domain(s)

uncharacterized Terpene Cyclase Like 1 N-term subgroup sequence, Isoprenoid Synthase Type II superfamily

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Abies balsamea Taxon ID: 90345 343174798 AEL99950.1 (Genbank)
Abies balsamea Taxon ID: 90345 544604144

Uniprot

Protein NameAccessionEC Number Identifier
Bifunctional abietadiene synthase, chloroplastic H8ZM70 4.2.3.18 LAS_ABIBA (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 844 | Length of Functional Domain: 327

1       10        20        30        40        50        60

QSIPHFSTTLNAGSSARKRRSLYLRWGKGSNKIIACVGEGATSVPYQSAEKNDSLYSSTL
VKREFPPGFWKDDLIDSLTSSHKVAASDEKRIETLISEIKNMFRCMGYGETNPSAYDTAW
VARIPALDGSDNPHFPETVEWILQNQLKDGSWGEGFYFLAYDRILATLACIITLTLWRTG
ETQVHKGIEFFRTQAGKMEDEADSHRPSGFEIVFPAMLKEAKILGLDLPYDLPFLKQIIE
KREAKLKRIPTDVLYALPTTLLYSLEGLQEIVDWQKIMKLQSKDGSFLSSPASTAAVFMR
TGNKKCLDFLNFVLKKFGNHVPCHYPLDLFERLWAVDTVERLGIDRHFKEEIKEALDYVY
SHWDERGIGWARENPVPDIDDTAMGLRILRLHGYNVSSDVLKTFRDENGEFFCFLGQTQR
GVTDMLNVNRCSHVSFPGETIMEEAKLCTERYLRNALENVDAFDKWAFKKNIRGEVEYAL
KYPWHKSMPRLEARSYIENYGPDDVWLGKTVYMMPYISNEKYLELAKLDFNKVQSIHQTE
LQDLRRWWKSSGFTDLNFTRERVTEIYFSPASFIFEPEFSKCREVYTKTSNFTVILDDLY
DAHGSLDDLKLFTESVKRWDLSLVDQMPQQMKICFVGFYNTFNEIAKEGRESQGRDVLGY
IQNVWKVQLEAYTKEAEWSEAKYVPSFNEYIENASVSIALGTVVLISALFTGEVLTDEVL
SKIDRGSRFLQLMGLTGRLVNDTKTYQAERGQGEVASAIQCYMKDHPKISEEEALKHVYT
VMENSLEELNREFVNNKIPDIYRRLVFETARIMQLFYMQGDGLTLSHDMEIKEHVKNCLF
QPVA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
597 Asp (D) side chain None --
601 Asp (D) side chain None --
741 Asn (N) side chain None --
Subgroup CAR This EFD conserves 8/8 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
560 Arg (R) side chain Hydrogen bonds to PPi electrostatic stabiliser -- spectator ICS PubMed:12432096
597 Asp (D) side chain Metal ligand metal ligand -- binding ICS PubMed:12432096
598 Asp (D) side chain None -- ISS PubMed:16895335
601 Asp (D) side chain Metal ligand metal ligand -- binding ICS PubMed:12432096
608 Asp (D) side chain Electrostatic interaction with R near N-terminus assists in active site closure electrostatic stabiliser -- spectator ICS PubMed:17372193
738 Arg (R) side chain Hydrogen bonds to PPi electrostatic stabiliser -- spectator ICS PubMed:12432096
741 Asn (N) side chain Metal ligand metal ligand -- binding ICS PubMed:12432096
742 Asp (D) side chain None -- ISS PubMed:16895335

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3S9V Abietadiene Synthase From Abies Grandis Abietadiene Synthase, Chloroplastic 10 2.3 CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
April 30, 2014, 12:12 p.m. update curation agent sbrown setDomainBoundaries.py
update domain start position 518 48
May 31, 2014, 11:43 a.m. update domain start position 48 518
EC number assigned by UniProtKB accession ID.