Top Level Name
⌊ Superfamily (core) Isoprenoid Synthase Type I
⌊ Subgroup Squalene/Phytoene Synthase Like
⌊ FunctionalDomain uncharacterized Squalene/phytoene Synthase Like subgroup sequence (ID 310126)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus Taxon ID: 1280 | 446100445 | WP_000178300.1 (RefSeq) | URP |
| Staphylococcus aureus subsp. aureus Taxon ID: 46170 | 861654179 | KMQ99758.1 (Genbank) | URP |
| Staphylococcus aureus subsp. anaerobius Taxon ID: 72759 | 815787506 | KKI67133.1 (Genbank) | URP |
| Staphylococcus aureus ZTA09/03745-9HSA Taxon ID: 1413584 | 617086431 | KAI71477.1 (Genbank) | URP |
| Staphylococcus aureus ZTA09/03734-9HSA Taxon ID: 1413582 | 617082772 | KAI67907.1 (Genbank) | URP |
| Staphylococcus aureus R0615 Taxon ID: 1413506 | 613275157 | EZY80792.1 (Genbank) | URP |
| Staphylococcus aureus R0611 Taxon ID: 1413505 | 613270191 | EZY75912.1 (Genbank) | URP |
| Staphylococcus aureus R0545 Taxon ID: 1413504 | 613265947 | EZY71739.1 (Genbank) | URP |
| Staphylococcus aureus R0487 Taxon ID: 1413503 | 613264152 | EZY69982.1 (Genbank) | URP |
| Staphylococcus aureus R0357 Taxon ID: 1413502 | 613261362 | EZY67264.1 (Genbank) | URP |
| Staphylococcus aureus R0353 Taxon ID: 1413501 | 613258543 | EZY64487.1 (Genbank) | URP |
| Staphylococcus aureus R0294 Taxon ID: 1413500 | 613257294 | EZY63252.1 (Genbank) | URP |
| Staphylococcus aureus PA57 Taxon ID: 1413490 | 613251632 | EZY57729.1 (Genbank) | URP |
| Staphylococcus aureus PA11 Taxon ID: 1413489 | 613249014 | EZY55153.1 (Genbank) | URP |
| Staphylococcus aureus P0218 Taxon ID: 1413512 | 613248659 | EZY54802.1 (Genbank) | URP |
| Staphylococcus aureus N1343 Taxon ID: 1413499 | 613245576 | EZY51753.1 (Genbank) | URP |
| Staphylococcus aureus N0426 Taxon ID: 1413498 | 613240909 | EZY47162.1 (Genbank) | URP |
| Staphylococcus aureus MSSA-93 Taxon ID: 1413492 | 613238855 | EZY45125.1 (Genbank) | URP |
| Staphylococcus aureus C3965 Taxon ID: 1413483 | 613146893 | EZX54534.1 (Genbank) | URP |
| Staphylococcus aureus C3489 Taxon ID: 1413454 | 613139223 | EZX46964.1 (Genbank) | URP |
| Staphylococcus aureus C2679 Taxon ID: 1413482 | 613126873 | EZX34862.1 (Genbank) | URP |
| Staphylococcus aureus C2549 Taxon ID: 1413481 | 613122572 | EZX30603.1 (Genbank) | URP |
| Staphylococcus aureus C0637 Taxon ID: 1413509 | 613106182 | EZX14539.1 (Genbank) | URP |
| Staphylococcus aureus C0630 Taxon ID: 1413508 | 613101720 | EZX10106.1 (Genbank) | URP |
| Staphylococcus aureus 122 Taxon ID: 1413491 | 612896969 | EZV08789.1 (Genbank) | URP |
| Staphylococcus aureus C0626 Taxon ID: 1413507 | 612748154 | EZT62863.1 (Genbank) | URP |
| Staphylococcus aureus C0676 Taxon ID: 1413511 | 612747067 | EZT61786.1 (Genbank) | URP |
| Staphylococcus aureus ZTA09/03739-9HSA Taxon ID: 1413583 | 612511831 | EZR33751.1 (Genbank) | URP |
| Staphylococcus aureus S94 Taxon ID: 1344581 | 528856349 | EPZ11677.1 (Genbank) | URP |
| Staphylococcus aureus S100 Taxon ID: 1344580 | 528848629 | EPZ04090.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21331 Taxon ID: 904766 | 365233427 | EHM74383.1 (Genbank) | URP |
| obsolete GI = 418311907 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A1K8C4N0 | A0A1K8C4N0_STAAU (TrEMBL) |
Length of Enzyme (full-length): 287 | Length of Functional Domain: 287
MTMMAMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
NQIKEDIQSIEKYPYEHHHFHSDRRIMRALQHVAQYKNIAFQSFYNLIDTVYKDQQFTMF
ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENE
RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPI
IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



