Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family mandelate racemase
⌊ FunctionalDomain uncharacterized mandelate racemase subgroup sequence (ID 300192)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA | 
| Family Assignment Evidence Code | IEA | 
| This entry was last updated on | Nov. 22, 2017 | 
References to Other Databases
Genbank
| Species | GI | Accession | Proteome | 
|---|---|---|---|
| Pseudomonas putida Taxon ID: 303 | 589911078 | URP | |
| Pseudomonas putida Taxon ID: 303 | 589911077 | URP | |
| Pseudomonas putida Taxon ID: 303 | 514829769 | URP | |
| Pseudomonas putida Taxon ID: 303 | 514829768 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977791 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977790 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977789 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977788 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977787 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977786 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977785 | URP | |
| Pseudomonas putida Taxon ID: 303 | 374977784 | URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number  | Identifier | 
|---|---|---|---|
| Mandelate racemase | P11444 | MANR_PSEPU (Swiss-Prot) | 
Length of Enzyme (full-length): 383 | Length of Functional Domain: 375
MASWSHPQFEKGALEVLFQGPGYHMSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVL
IDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGY
TGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAA
ELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEG
VTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGG
VTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGN
AVIPDLPGVGIIWREKEIGKYLV
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.

 
		
