Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup spore photoproduct lyase like

     ⌊ Family spore photoproduct lyase 2

  ⌊ FunctionalDomain Spore photoproduct lyase (ID 280390)

Superfamily Assignment Evidence Code(s) ISS PubMed:19178276 PubMed:20405152
Family Assignment Evidence Code CFM PubMed:19178276 PubMed:20405152
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Clostridium acetobutylicum ATCC 824 Taxon ID: 272562 15893987 NP_347336.1 (RefSeq) URP
Clostridium acetobutylicum Taxon ID: 1488 499266625 WP_010964018.1 (RefSeq) URP
Clostridium acetobutylicum ATCC 824 Taxon ID: 272562 15023578 AAK78676.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Spore photoproduct lyase Q97L63 4.1.99.14 SPLB_CLOAB (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 336 | Length of Functional Domain: 335

1       10        20        30        40        50        60

MENMFRRVIFEKKALDYPMGRDILRQFENTDIEIRYSETGRITGIPGKDEAQSFFEGKNT
LVVGVRRELDFQTCKPSANYQLPIVSGCAAMCEYCYLNTHGGKKPYVKINVNLDDILSKA
GEYIEKRKPDITVFEGAAISDPVPVERYSGALKKAIEYFGKNEYSRFRFVTKYADISELL
AVQHNNHTTIRFSINTPRVIKNYEHRTSSLEDRIESAYNILNSGYKTGFIVGPVFLYENW
KKEYEELLKKASDKLGDKELEFEIISHRFTTSAKNKILKVFPNTKLPMDDEARKFKFGQF
GYGKYVYDKDDMQEIKEFFINNINLYFNKATIKYII
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
88 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
92 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
95 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
88 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
92 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
95 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
96 Tyr (Y) side chain Hydrogen radical shuttle hydrogen relay -- reactant IEA
Family CAR This EFD conserves 5/5 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
74 Cys (C) side chain Hydrogen radical shuttle hydrogen relay -- reactant IEA
88 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
92 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
95 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
96 Tyr (Y) side chain Hydrogen radical shuttle hydrogen relay -- reactant IEA

Catalyzed Reaction

spore photoproduct lyase

(5R)-5,6-dihydro-5-(thymidin-7-yl)thymidine (in double-helical DNA)
85625		 Two thymine residues (in DNA)
81146

EC: 4.1.99.14 | IntEnz: 4.1.99.14 | Kegg: 4.1.99.14 | BioCyc: 4.1.99.14 | BRENDA: 4.1.99.14

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:01 a.m. update curation agent holliday setDomainBoundaries.py
update domain start position 1 2
July 15, 2014, 3:59 a.m. update curation agent setDomainBoundaries.py holliday
Oct. 16, 2014, 3:54 a.m. update curation agent holliday setDomainBoundaries.py
May 11, 2015, 8:45 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.