Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ main SPASM domain-containing

  ⌊ heme carboxy lyase like

     ⌊ Family C-terminal tyrosine decarboxylase (MftC-like)

  ⌊ FunctionalDomain Mycofactocin, radical SAM peptide maturase (ID 280108)

Superfamily Assignment Evidence Code(s) ISS PubMed:21223593
Family Assignment Evidence Code CFM PubMed:21223593
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Mycobacterium bovis AF2122/97 Taxon ID: 233413 31791877 NP_854370.1 (RefSeq) URP
Mycobacterium tuberculosis H37Rv Taxon ID: 83332 15607833 NP_215207.1 (RefSeq) PRP URP
Taxon ID: 77643 489498579 WP_003403490.1 (RefSeq)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Putative mycofactocin radical SAM maturase MftC P9WJ78 2.-.-.- MFTC_MYCTO (Swiss-Prot)
Putative mycofactocin radical SAM maturase MftC P9WJ79 2.-.-.- MFTC_MYCTU (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 391 | Length of Functional Domain: 353

1       10        20        30        40        50        60

MTSPVPRLIEQFERGLDAPICLTWELTYACNLACVHCLSSSGKRDPGELSTRQCKDIIDE
LERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGVKFSTNGVRITPEVATRLAATDYVD
VQISLDGATAEVNDAIRGTGSFDMAVRALQNLAAAGFAGVKISVVITRRNVAQLDEFAT
L
ASRYGATLRITRLRPSGRGTDVWADLHPTADQQVQLYDWLVSKGERVLTGDSFFHLAPLG
QSGALAGLNMCGAGRVVCLIDPVGDVYACPFAIHDHFLAGNVLSDGGFQNVWKNSSLFRE
LREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPECVQGHSEPALARER
HLPRPR
ADHSRGRRVSKPVPLTLSMRPPKRPCNESPV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
34 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
37 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 7/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
34 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
37 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
310 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
313 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
319 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
341 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:21223593
34 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:21223593
37 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:21223593
310 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS PubMed:21223593
313 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS PubMed:21223593
319 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS PubMed:21223593
323 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS PubMed:21223593

Catalyzed Reaction

C-terminal tyrosine decarboxylase

+
Val-Tyr
73703
N-[(E)-2-(4-Hydroxyphenyl)ethenyl]-3-methylbutanamide
69738
formic acid
30751

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History

Time Change Annotation Old Value New Value
May 14, 2014, 3 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 219 391
update domain start position 20 2
July 15, 2014, 3:58 a.m. update curation agent setDomainBoundaries.py holliday
update family assignment evidence code CFM,ISS CFM
Oct. 16, 2014, 3:53 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 3:52 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 391 354
update subgroup SPASM/twitch domain containing heme carboxy lyase like
EC number assigned by UniProtKB accession ID.