Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.4: Theta-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Theta class GSTs (ID 235125)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Drosophila sechellia Taxon ID: 7238 195329588 XP_002031492.1 (RefSeq) URP
Drosophila sechellia Taxon ID: 7238 194120435 EDW42478.1 (Genbank) URP
Drosophila sechellia Taxon ID: 7238 378405180 URP

Uniprot

Protein NameAccessionEC Number Identifier
Glutathione S-transferase 1-1 P30106 2.5.1.18 GSTT1_DROSE (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 209 | Length of Functional Domain: 209

1       10        20        30        40        50        60

MADFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLRAGEHLKPEFLKINPQHTIPTLVDNG
FALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAK
APADPEAFKKIESAFEFLNTFLEGQEYAAGDSLTVADIALVASVSTFEVAGFEISKYANV
NKWYENAKKVTPGWEENWAGCLEFKKFFE
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 1/1 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
10 Ser (S) side chain None -- IME PubMed:22579926

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3MAK Crystal Structure Of Glutathione Transferase Dmgstd1 From Drosophila Melanogaster, In Complex With Glutathione Glutathione S-Transferase 1-1 17 1.8 Glutathione CSA • PDB • PDBSum
3EIN Delta Class Gst Glutathione S-Transferase 1-1 17 1.13 Glutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:31 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 190 209
update domain start position 2 1
EC number assigned by UniProtKB accession ID.