Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Phi class GSTs (ID 234537)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Zea mays Taxon ID: 4577 | 413952343 | AFW84992.1 (Genbank) | URP |
| n/a | 260058302 | ACX27919.1 (Genbank) | |
| Zea mays Taxon ID: 4577 | 224034943 | ACN36547.1 (Genbank) | URP |
| Zea mays Taxon ID: 4577 | 195629442 | ACG36362.1 (Genbank) | URP |
| Zea mays Taxon ID: 4577 | 195620970 | ACG32315.1 (Genbank) | URP |
| Zea mays Taxon ID: 4577 | 195609544 | ACG26602.1 (Genbank) | URP |
| Zea mays Taxon ID: 4577 | 195606906 | ACG25283.1 (Genbank) | URP |
| synthetic construct Taxon ID: 32630 | 554565 | AAA72758.1 (Genbank) | |
| Zea mays Taxon ID: 4577 | 257737836 | URP | |
| Zea mays Taxon ID: 4577 | 257737316 | URP | |
| Zea mays Taxon ID: 4577 | 257343783 | URP | |
| Zea mays Taxon ID: 4577 | 257343641 | URP | |
| Zea mays Taxon ID: 4577 | 257293310 | URP | |
| Zea mays Taxon ID: 4577 | 257293168 | URP | |
| Zea mays Taxon ID: 4577 | 219901339 | URP | |
| Zea mays Taxon ID: 4577 | 219899527 | URP | |
| Zea mays Taxon ID: 4577 | 219745006 | URP | |
| Zea mays Taxon ID: 4577 | 219744862 | URP | |
| Zea mays Taxon ID: 4577 | 219740360 | URP | |
| Zea mays Taxon ID: 4577 | 219740216 | URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | B6SKA0 | B6SKA0_MAIZE (TrEMBL) |
Length of Enzyme (full-length): 214 | Length of Functional Domain: 212
MAPMKLYGAVMSWNVTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQD
GDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLIS
PMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPY
ASVLDAYPHVKAWWSGLMERPSVQKVAALMKPSA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



