Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Nu class GSTs (ID 234474)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Feb. 14, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 620 | 491169070 | WP_005027440.1 (RefSeq) | |
| Shigella sonnei Taxon ID: 624 | 821338658 | AKH31869.1 (Genbank) | URP |
| Shigella dysenteriae 225-75 Taxon ID: 766143 | 391299500 | EIQ57464.1 (Genbank) | URP |
| Shigella dysenteriae CDC 74-1112 Taxon ID: 941429 | 320175678 | EFW50767.1 (Genbank) | URP |
| obsolete GIs = 420381993, 416266385 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | I6FMH2 | I6FMH2_SHIDY (TrEMBL) | |
| n/a | E7SIB2 | E7SIB2_SHIDY (TrEMBL) |
Length of Enzyme (full-length): 288 | Length of Functional Domain: 223
MTDNTYQPAKVWTWDKSAGGAFANINRPVSGPTHEKTLPVGKHPLQLYSLGTPNGQKVTI
MLEELLALGVTGAEYDAWLIRIGDGDQFSSGFVEVNPNSKIPALRDHTHNPPIRVFESGS
ILLYLAEKFGYFLPQDLAKRTETMNWLFWLQGAAPFLGGGFGHFFHYAPVKIEYAINRFT
MEAKRLLDVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLGGVYDAAEFLDAGSYKHVQ
RWAKEVGERPAVKRGRIVNRTNGPLNEQLHERHDASDFETNTEDKRQG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



