Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Zeta class GSTs (ID 233591)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Macaca fascicularis Taxon ID: 9541 | 567316101 | NP_001274598.1 (RefSeq) | URP |
Macaca nemestrina Taxon ID: 9545 | 795449395 | XP_011764007.1 (RefSeq) | |
Macaca mulatta Taxon ID: 9544 | 297298332 | XP_002805178.1 (RefSeq) | PRP URP |
Macaca fascicularis Taxon ID: 9541 | 126572449 | ABO21636.1 (Genbank) | URP |
obsolete GI = 544448684 | |||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | A0A1D5RJE8 | A0A1D5RJE8_MACMU (TrEMBL) | |
n/a | C0SJM6 | C0SJM6_MACFA (TrEMBL) |
Length of Enzyme (full-length): 217 | Length of Functional Domain: 209
MTESGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQV
PALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVL
KQVGEEFQLTWAQNAIISGFNALEQILQSTAGTYCVGDEVTMADLCLVPQVANAERFKVD
CTPYPTISSINKRLLVLEAFQVTHPCRQPDTPTELRA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.