Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Nu class GSTs (ID 233575)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Feb. 14, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 485705248 | WP_001338028.1 (RefSeq) | URP |
| Escherichia coli 908519 Taxon ID: 1268991 | 553621578 | ESD41212.1 (Genbank) | URP |
| Escherichia coli UMEA 3117-1 Taxon ID: 1281185 | 535541249 | EQW79447.1 (Genbank) | URP |
| Escherichia coli KTE46 Taxon ID: 1182653 | 431306149 | ELF94462.1 (Genbank) | URP |
| Escherichia coli KTE45 Taxon ID: 1169362 | 431272664 | ELF63763.1 (Genbank) | URP |
| Escherichia coli MS 57-2 Taxon ID: 749529 | 324005426 | EGB74645.1 (Genbank) | URP |
| obsolete GIs = 432733756, 422383368, 432760842 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | V0V761 | V0V761_ECOLX (TrEMBL) |
Length of Enzyme (full-length): 288 | Length of Functional Domain: 222
MTDNTYQPAKVWTWDKSAGGAFASINRPVSGPTHEKTLPVGKHPLQLYSLGTPNGQKVTI
MLEELLALGVTGAEYDAWLIRIGDGDQFSSGFVEVNPNSKIPALRDHTHNPPIRVFESGS
ILLYLAEKFDYFLPQDLAKRTETMSWLFWLQGAAPFLGGGFGHFYHYAPVKIEYAINRFT
MEAKRLLDVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLGGVYDAAEFLDAGSYKHVQ
RWAKEVGERPAVKRGRIVNRINGPLNEQLHERHDASDFETNTEDKRQG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



