Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  Main.2: Nu-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Nu class GSTs (ID 232623)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onFeb. 14, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Escherichia coli Taxon ID: 562 485699563 WP_001332913.1 (RefSeq) URP
Escherichia coli 2-011-08_S1_C1 Taxon ID: 1444037 632159456 KDA56446.1 (Genbank) URP
Escherichia coli MS 78-1 Taxon ID: 749532 300847521 EFK75281.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A062Y7U3 A0A062Y7U3_ECOLX (TrEMBL)

Sequence

Length of Enzyme (full-length): 288 | Length of Functional Domain: 223

1       10        20        30        40        50        60

MTDDTYQPAKVWTWDKSAGGAFANINRPVSGPTHEKTLPVGKHPLQLYSLGTPNGQKVSI
MLEELLALGVTGAEYDAWLIRIGDGDQFSSGFVEVNPNSKIPALRDHTHTPPIRVFESGS
ILLYLAEKFGYFLPQDLAKRTEAMNWLFWLQGAAPFLGGGFGHFYHYAPVKIEYAINRFT
MEAKRLLDVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLGGVYDAAEFLDAGSYKHVQ
RWAKEVGERPAVKRGRIVNRTNGP
LNEQLHERHDASDFETNTEDKRQG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3C8E Crystal Structure Analysis Of Yghu From E. Coli Yghu, Glutathione S-Transferase Homologue 41 1.5 Glutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:26 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 249 264
update domain start position 45 42
EC number assigned by UniProtKB accession ID.