Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Phi class GSTs (ID 232165)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Zea mays Taxon ID: 4577 | 195647344 | ACG43140.1 (Genbank) | URP |
| Zea mays Taxon ID: 4577 | 257737310 | URP | |
| Zea mays Taxon ID: 4577 | 257343635 | URP | |
| Zea mays Taxon ID: 4577 | 257293162 | URP | |
| Zea mays Taxon ID: 4577 | 219899521 | URP | |
| Zea mays Taxon ID: 4577 | 219744856 | URP | |
| Zea mays Taxon ID: 4577 | 219739466 | URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | B6U1A7 | B6U1A7_MAIZE (TrEMBL) |
Length of Enzyme (full-length): 214 | Length of Functional Domain: 212
MAPMKLYGAVMSWNVTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQD
GDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLIS
PMLGGSTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPY
ASVLDAYPHVKAWWSGLMERPSVQKVAALMKPSA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



