Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.5: Phi-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Phi class GSTs (ID 231480)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Arabidopsis lyrata subsp. lyrata Taxon ID: 81972 297809899 XP_002872833.1 (RefSeq) URP
Arabidopsis lyrata subsp. lyrata Taxon ID: 81972 297318670 EFH49092.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a D7M3G8 D7M3G8_ARALL (TrEMBL)

Sequence

Length of Enzyme (full-length): 212 | Length of Functional Domain: 212

1       10        20        30        40        50        60

MAGIKVFGHPASIATRRVLIALHEKNLDFELVHIELKDGEHKKEPFLSRNPFGQVPAFED
GDLKLFESRAITQYIAHQYENQGTNLLQADPKNISQYAIMAIGMQVEAHQFDPVASKLAW
EQLFKSIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAIQYL
LGTPTKKLFTERPRVNEWVAEITKRPASEKVL
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 1/1 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
12 Ser (S) side chain None -- ICS PubMed:9417936

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
5A4V Atgstf2 From Arabidopsis Thaliana In Complex With Quercetin Glutathione S-Transferase F2 3 2.38 Acetate Ion • 3,5,7,3',4'-Pentahydroxyflavone CSA • PDB • PDBSum
5A4W Atgstf2 From Arabidopsis Thaliana In Complex With Quercetrin Glutathione S-Transferase F2 3 2.25 2-(3,4-Dihydroxyphenyl)-5,7-Dihydroxy-4-Oxo-4H-Chromen-3-Yl 6-Deoxy-Alpha-L-Mannopyranoside • Acetate Ion CSA • PDB • PDBSum
5A5K Atgstf2 From Arabidopsis Thaliana In Complex With Camalexin Glutathione S-Transferase F2 3 2.77 (2Z)-2-Indol-3-Ylidene-3H-1,3-Thiazole CSA • PDB • PDBSum
5A4U Atgstf2 From Arabidopsis Thaliana In Complex With Indole-3-Aldehyde Glutathione S-Transferase F2 3 2.0 1H-Indole-3-Carbaldehyde • Acetate Ion CSA • PDB • PDBSum
1BX9 Glutathione S-Transferase In Complex With Herbicide Glutathione S-Transferase • Foe-4053-Glutathione Conjugate Ggl-Foe-Gly 5 2.6 L-Glutamic Acid • 2-(2-Amino-3-Oxo-Propylsulfanyl)-N-(4-Fluoro-Phenyl)-N-Isopropyl-Acetamide CSA • PDB • PDBSum
1GNW Structure Of Glutathione S-Transferase Glutathione S-Transferase 5 2.2 S-Hexylglutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:24 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 205 212
update domain start position 4 1
EC number assigned by UniProtKB accession ID.