Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Theta class GSTs (ID 230283)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank: obsolete GI = 232193
Length of Enzyme (full-length): 200 | Length of Functional Domain: 200
GSSPCRSVIMTAKAVGVELNKKLLNLRAGEHLKPEFLKINPQHTIPTLVDNGFALWESRA
IQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAF
KKIESAFEFLNTFLEGQEYAAGDSLTVADIALVASVSTFEVAGFEISKYANVNKWYENAK
KVTPGWSENWAGCLEFKKFF
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



