Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Theta class GSTs (ID 228839)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Anopheles dirus Taxon ID: 7168 | 11596150 | AAG38505.1 (Genbank) | |
| Anopheles cracens Taxon ID: 123217 | 10443881 | AAG17623.1 (Genbank) | |
| Anopheles cracens Taxon ID: 123217 | 22218860 | ||
| Anopheles cracens Taxon ID: 123217 | 22218859 | ||
| Anopheles cracens Taxon ID: 123217 | 22218858 | ||
| Anopheles cracens Taxon ID: 123217 | 22218857 | ||
| Anopheles cracens Taxon ID: 123217 | 22218856 | ||
| Anopheles cracens Taxon ID: 123217 | 22218855 | ||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | Q9GNE9 | Q9GNE9_9DIPT (TrEMBL) | |
| n/a | Q7KIF2 | Q7KIF2_9DIPT (TrEMBL) |
Length of Enzyme (full-length): 209 | Length of Functional Domain: 209
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKINPQHCIPTLVDNGF
ALWESRAICTYLAEKYGKDDKLYPKDPQKRAVVNQRLYFDMGTLYQRFADYYYPQIFAKQ
PANAENEKKMKDAVDFLNTFLDGHKYVAGDSLTIADLTVLATVSTYDVAGFELAKYPHVA
AWYERTRKEAPGAAINEAGIEEFRKYFEK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



