Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.13
⌊ FunctionalDomain cytGST-like protein (ID 228258)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 482 | 489807181 | WP_003711050.1 (RefSeq) | |
| Neisseria lactamica ATCC 23970 Taxon ID: 546265 | 673468999 | KFJ35629.1 (Genbank) | URP |
| Neisseria lactamica ATCC 23970 Taxon ID: 546265 | 269208220 | EEZ74675.1 (Genbank) | URP |
| Neisseria lactamica 020-06 Taxon ID: 489653 | 313006632 | URP | |
| Neisseria lactamica Y92-1009 Taxon ID: 869214 | 309379562 | URP | |
| obsolete GIs = 421863031, 261401692, 313669170 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | D0WCP0 | D0WCP0_NEILA (TrEMBL) | |
| n/a | A0A1V0DSP3 | A0A1V0DSP3_NEILA (TrEMBL) | |
| n/a | E4ZA26 | E4ZA26_NEIL0 (TrEMBL) |
Length of Enzyme (full-length): 201 | Length of Functional Domain: 201
MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVL
HESNIINEYIDERFPHPQLMPGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAK
AREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWRLDHYDVKLGKSAAPLLKYAE
RIFQREAFIDALTPAEKAMRK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



