Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.13

  ⌊ FunctionalDomain cytGST-like protein (ID 224941)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Neisseria polysaccharea Taxon ID: 489 489847274 WP_003750963.1 (RefSeq)
Neisseria polysaccharea ATCC 43768 Taxon ID: 546267 296839452 EFH23390.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a E2PDV4 E2PDV4_NEIPO (TrEMBL)

Sequence

Length of Enzyme (full-length): 201 | Length of Functional Domain: 201

1       10        20        30        40        50        60

MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVL
HESNIINEYIDERFPHPQLMPGDPVMRGRGRLVLYRMEKELFNHAQVLENPAATNKEQAK
AREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWRLDHYDVKLGKSAAPLLKYAE
RIFQREAFIEALTPAEKAMRK
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4HOJ Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Regf Protein 7 1.4 Calcium Ion
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:31 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 185 201
update domain start position 2 1
EC number assigned by UniProtKB accession ID.