Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ Family phosphonoacetaldehyde hydrolase
⌊ FunctionalDomain phosphonoacetaldehyde hydrolase (ID 22261)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
Family Assignment Evidence Code | IEA |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Taxon ID: 86661 | 446610034 | WP_000687380.1 (RefSeq) | |
Bacillus thuringiensis Taxon ID: 1428 | 753590325 | AJH69175.1 (Genbank) | URP |
Bacillus cereus D17 Taxon ID: 1454382 | 753295415 | AJG59360.1 (Genbank) | URP |
Bacillus thuringiensis str. Al Hakam Taxon ID: 412694 | 145566919 | URP | |
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
Phosphonoacetaldehyde hydrolase {ECO:0000255|HAMAP-Rule:MF_01375} | A0RBE8 | PHNX_BACAH (Swiss-Prot) |
Length of Enzyme (full-length): 264 | Length of Functional Domain: 264
MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFYKRGVGITAEEARKPMGLLKIDHVRALTEM
PRIANEWNRIFGQLPTETDIQEMYEEFEEILFAILPRYASPIHGVKEVIASLRERGIKIG
STTGYTREMMDIVAKEAALQGYKPDFLVTPDDVPAGRPYPWMCYKNAMELGVYPMNHMIK
IGDTVSDMKEGRNAGMWTVGVILGSSELGLSEEEVENMDSAELREKIEVVRNRFVENGAH
FTIETMQELESVMERIEKQELIIS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.