Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ Family phosphonoacetaldehyde hydrolase
⌊ FunctionalDomain phosphonoacetaldehyde hydrolase (ID 22247)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Bacillus anthracis Taxon ID: 1392 | 675838971 | AIM10643.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 675833562 | AIM05235.1 (Genbank) | URP |
| Bacillus anthracis str. SVA11 Taxon ID: 1392837 | 589080917 | AHK37432.1 (Genbank) | URP |
| Bacillus anthracis str. H9401 Taxon ID: 768494 | 384384979 | AFH82640.1 (Genbank) | URP |
| Bacillus anthracis str. A0248 Taxon ID: 592021 | 229266563 | ACQ48200.1 (Genbank) | URP |
| Bacillus cereus BGSC 6E1 Taxon ID: 526970 | 228599860 | EEK57457.1 (Genbank) | URP |
| Bacillus anthracis str. CDC 684 Taxon ID: 568206 | 227007347 | ACP17090.1 (Genbank) | URP |
| Bacillus anthracis Taxon ID: 1392 | 821587770 | URP | |
| obsolete GIs = 229183617, 65318692, 487928879, 386735127, 229602155, 227815832, 672925993, 570717308, 570711405 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0E0VX83 | A0A0E0VX83_BACAN (TrEMBL) | |
| n/a | C2NET5 | C2NET5_BACCE (TrEMBL) |
Length of Enzyme (full-length): 267 | Length of Functional Domain: 267
MDCMKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHKRGVGITAEEARKPMGLLKIDHVRAL
TEMPRIANEWNRIFGQLPTETDIQEMYEEFEEILFAILPRYASPIHGVKEVIASLRERGI
KIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDDVPAGRPYPWMCYKNAMELGVYPMNH
MIKIGDTVSDMKEGRNAGMWTVGVILGSSELGLSEEEVENMDPAELREKIEVVRNRFVEN
GAHFTIETMQELESVMERIEKQELIIS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



