Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ Family phosphonoacetaldehyde hydrolase
⌊ FunctionalDomain phosphonoacetaldehyde hydrolase (ID 22215)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 86661 | 446610020 | WP_000687366.1 (RefSeq) | |
| Bacillus cereus Taxon ID: 1396 | 859572144 | KMP94300.1 (Genbank) | URP |
| Bacillus thuringiensis Taxon ID: 1428 | 827033212 | AKJ57950.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 821642069 | KLA22862.1 (Genbank) | URP |
| Bacillus thuringiensis serovar mexicanensis Taxon ID: 180868 | 803762342 | KKB32638.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki Taxon ID: 29339 | 756043166 | AJK42268.1 (Genbank) | URP |
| Bacillus thuringiensis serovar galleriae Taxon ID: 29338 | 734581621 | AJA18833.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki str. YBT-1520 Taxon ID: 570416 | 676322280 | AIM33119.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki str. HD-1 Taxon ID: 1261129 | 661908496 | AIE32681.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki str. HD-1 Taxon ID: 1261129 | 657515494 | KEH48266.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki str. YBT-1520 Taxon ID: 570416 | 633269502 | AHZ50279.1 (Genbank) | URP |
| Bacillus thuringiensis Taxon ID: 1428 | 595878379 | EXY07900.1 (Genbank) | URP |
| Bacillus thuringiensis serovar aizawai str. Hu4-2 Taxon ID: 1238885 | 565334030 | ETE96958.1 (Genbank) | URP |
| Bacillus thuringiensis serovar aizawai str. Leapi01 Taxon ID: 1232203 | 565327254 | ETE90182.1 (Genbank) | URP |
| Bacillus cereus VD140 Taxon ID: 1053235 | 500536269 | EOQ01199.1 (Genbank) | URP |
| Bacillus cereus BMG1.7 Taxon ID: 1053196 | 500530178 | EOP95308.1 (Genbank) | URP |
| Bacillus cereus ISP2954 Taxon ID: 1053215 | 500457418 | EOP69703.1 (Genbank) | URP |
| Bacillus cereus HuB13-1 Taxon ID: 1053208 | 500422127 | EOP37070.1 (Genbank) | URP |
| Bacillus cereus VD133 Taxon ID: 1053233 | 500319498 | EOO39586.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki str. HD73 Taxon ID: 1279365 | 449021970 | AGE77133.1 (Genbank) | URP |
| Bacillus cereus HD73 Taxon ID: 1053200 | 402455502 | EJV87285.1 (Genbank) | URP |
| Bacillus cereus BAG3X2-2 Taxon ID: 1053184 | 401115194 | EJQ23047.1 (Genbank) | URP |
| Bacillus thuringiensis serovar kurstaki str. T03a001 Taxon ID: 527023 | 228807728 | EEM54249.1 (Genbank) | URP |
| Bacillus cereus Taxon ID: 1396 | 145566921 | URP | |
| obsolete GIs = 423504980, 423423504, 228951805, 544381136, 544378712, 449088213 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Phosphonoacetaldehyde hydrolase | O31156 | 3.11.1.1 | PHNX_BACCE (Swiss-Prot) |
Length of Enzyme (full-length): 264 | Length of Functional Domain: 264
MKIEAVIFDWAGTTVDYGCFAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEM
PRIASEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRERGIKIG
STTGYTREMMDIVAKEAALQGYKPDFLVTPDDVPAGRPYPWMCYKNAMELGVYPMNHMIK
VGDTVSDMKEGRNAGMWTVGVILGSSELGLTEEEVENMDSVELREKIEVVRNRFVENGAH
FTIETMQELESVMEHIEKQELIIS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



